DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1124 and to

DIOPT Version :9

Sequence 1:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster


Alignment Length:257 Identity:68/257 - (26%)
Similarity:108/257 - (42%) Gaps:26/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AVCLVIVIQALRMVQAETPPYIKQCHRNDPKLVDCFIGAIEHL-KPYLANGIPDIQLPSVEPFKM 67
            |:...:|:..|..|.|:.|...|.|...|.   :|.:.....| ....|.|.|.:.|..::|.|:
  Fly     3 AIAFAVVLCLLVSVDAKFPEDPKPCKYGDG---ECIMKLCNTLFSENSAEGDPGLNLMQLDPLKV 64

  Fly    68 DTLALQLTE--GPQGYKITLKNMEAFGASNFKVTSLK-----LSEGSEPFKAKIVMPKLKIEAKY 125
            |.:.:...|  .|.|..:|..:...:|..:.::..:|     |:...|   .|||.....:...|
  Fly    65 DRMVISQGESSSPVGITLTFTDNLLYGIKDQRIVKVKGFGRDLTAKHE---VKIVTKTFSLVGPY 126

  Fly   126 TSSGVLLILPASGGGDFHANFEGVSA--DLTGKTSIHAFKGANYLHIDALSLVLDVKDVKMSISG 188
            ...|.:||||.||.|..:.....|.|  ..:||..:.  .|..||.:..|.:.:..:......|.
  Fly   127 NIQGKVLILPISGTGQSNMTMVNVRAIVSFSGKPLVK--NGETYLDVTDLKITMKPESSHYHFSN 189

  Fly   189 AFNNNRILLEATNLFLRENSQVVLEAMQAQLQKKLASEFGKLANQLLKNV----PVEQFYVD 246
            .||.::.|.:..|:||.|||    ||:..:..|.:...||||...::|.|    |..:|:.|
  Fly   190 LFNGDKALGDNMNVFLNENS----EAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFFAD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1124NP_649509.1 JHBP 6..244 CDD:284096 65/251 (26%)
toNP_001287525.1 JHBP 5..245 CDD:284096 65/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470472
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.