DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1124 and CG17279

DIOPT Version :8

Sequence 1:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_650937.3 Gene:CG17279 / 42489 FlyBaseID:FBgn0038850 Length:245 Species:Drosophila melanogaster

Alignment Length:258 Identity:57/259 (22%)
Similarity:101/259 (39%) Gaps:33/259 (13%)


  Fly     7 LVIVIQALRMVQA--ETPPYIKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDIQLPSVEPFKMDT 69
            |::.:..|.|..:  :.||.|::|...|...:...:..|..|.|   .|:|.|.|.:::....:.
  Fly     3 LIVFVCCLWMAPSLGQLPPEIEKCRAGDSICIAETVTRILRLYP---KGLPSIGLVALDSIGFED 64

  Fly    70 LALQLTE--GPQGYKITLKNMEAFGASNFKVTSLKLSEGSEPFKAKIV--MPKLKIEAKYTSSGV 130
            :.:...|  |...:.:...|:...|.::..||..|..:...|...::.  :|.||:...|...|.
  Fly    65 VVVSRLEPDGSSTFDLKFPNLTVIGFADSTVTEAKGFDADLPRVLELSGWIPLLKLNGTYEMRGS 129

  Fly   131 LLILPASGGGDFHANFE--------GVSADLTGKTSIHAFKGANYLHIDALSLVLDVKDVKMSIS 187
            ||.:|..|.|.......        .|..||..       .|..|..|..:..:|||:.:.:::.
  Fly   130 LLTMPIHGKGQAKVEIRECRVRCKVRVLEDLRD-------DGKLYAGISKVKCLLDVQGMHLNLE 187

  Fly   188 GAFNNNRILLEATNLFLRENSQVVLEAMQAQLQKKLASEFGKLANQLLKNV----PVEQFYVD 246
            ..|||.. :.:|.|:.....   .||... .|::.:.|...:|...:|:.|    |.:..|.|
  Fly   188 NLFNNPE-MSDAMNVVANTK---WLEIWH-NLRRGITSAVDQLVESILQRVANKLPYDDLYRD 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1124NP_649509.1 JHBP 6..244 CDD:284096 55/255 (22%)
CG17279NP_650937.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1402175
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.