DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1124 and CG10407

DIOPT Version :9

Sequence 1:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster


Alignment Length:216 Identity:61/216 - (28%)
Similarity:109/216 - (50%) Gaps:20/216 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ETPPYIKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDIQLPSVEPFKMDTLALQLTEGPQGYKIT 84
            :.|.::|.||||.|.|..|...:.|.|:|.|..|||::.:|::||..:..:.:....|.......
  Fly    33 QLPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAMEPLVVPQVKMDQDSGAIYLHSV 97

  Fly    85 LKNMEAFGASNFKVTSLKLSEGSEPFKAKIVM----PKLKIEAKY----TSSGVLLILPASGGGD 141
            .:|::..|.|...|..|:|    ||.|.|.::    |||.:|:.|    :..|.::::|..|.| 
  Fly    98 YRNVKVTGISKHTVNELRL----EPSKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPLLGDG- 157

  Fly   142 FHANFEGVSADLTGKTSI----HAFKGANYLHIDALSLVLDVKDVKMSISGAFNNNRILLEATNL 202
             |...:.|  ::|.:|.:    :...|||:|.|:.:.:..::.||.:.:...||.::.|.:..|.
  Fly   158 -HCKVDLV--NITMRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALGDRMNE 219

  Fly   203 FLRENSQVVLEAMQAQLQKKL 223
            ||.||.:.:.|.::..:.|.|
  Fly   220 FLNENWKALAEEVRPLMTKAL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1124NP_649509.1 JHBP 6..244 CDD:284096 61/216 (28%)
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 61/216 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.