DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14661 and CG14259

Sequence 1:NP_001246918.1 Gene:CG14661 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_651532.1 Gene:CG14259 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster

Alignment Length:262 Identity:67/263 (25%)
Similarity:111/263 (42%) Gaps:60/263 (23%)


  Fly    11 LICFVACISAGNMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKEL--NVPPLEPLYIGDLS 73
            |:..||..|  ..|.::..|...:|..:||..:|:..|...|..||.|:  ...|.:|:.:.|:.
  Fly    32 LVSAVAYYS--EKPAFLPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEVLERFGPFDPMRVRDIV 94

  Fly    74 I-LDGSAGLTVKAK--KLNILGASNFEITKLRASTQNRRFDFELILPHLHGDGLYEINGNILALP 135
            . .|.:...|::|.  .|.:.|.:|.::.:.|.|.::..:..::.||.:..||.||:.|.||.:|
  Fly    95 FKQDNNEVATIRANLTDLVVKGFANTKVKESRVSKKDFSWQTKIYLPKMRLDGRYEMAGRILLIP 159

  Fly   136 IKGNGPF-------------------TGNFT-NFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTG 180
            :.|:|..                   .|.|| :.|..|:||.::.               |:|| 
  Fly   160 LSGSGKIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQLNLS---------------KVRT- 208

  Fly   181 KGNLKLENLFNG-DKVLGDVINDTINQNFEVFTNDLIAPIARALEAKFLVITTKILENFTYSELF 244
                .|:||||| .|.:....|:..|:|:..|...|          |.|::.|  :||..|..:.
  Fly   209 ----YLDNLFNGRSKEVERSTNEFFNENWRDFYEAL----------KPLIVET--VENILYDVMS 257

  Fly   245 PV 246
            .|
  Fly   258 TV 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:284096 66/260 (25%)
CG14259NP_651532.1 JHBP 32..269 CDD:284096 67/263 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1400473
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.