DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14661 and CG14258

Sequence 1:NP_001246918.1 Gene:CG14661 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_651531.1 Gene:CG14258 FlyBaseID:FBgn0039482 Length:258 Species:Drosophila melanogaster

Alignment Length:267 Identity:62/268 (23%)
Similarity:105/268 (39%) Gaps:54/268 (20%)


  Fly     2 QFQLIVASLLICFVACISAGNMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELN-VPPLE 65
            :|..|||.||............||::..|...||..:.||..:..:.......||...| |...:
  Fly     7 KFLSIVAVLLSAVEGAKYLAEKPDFLIPCIVGDPNFNVCLTKNFQSFFRQWKDGIPGYNAVGSFD 71

  Fly    66 PLYIGDLSIL-DGSAGLTVKA--KKLNILGAS-----------NFEITKLRASTQNRRFDFELIL 116
            |.||..:... |.|..:.:.|  |::.:.||.           |..:.:...|....||:|:   
  Fly    72 PFYIKRVKFTQDASRSIAINADLKEVYVAGAGQALVLESSWDPNHYVARTLISVPKLRFNFD--- 133

  Fly   117 PHLHGDGLYEINGNILALPIKGNGPFTGNFTNFVAYVRVQY-------------DIKSVNDLEYL 168
                    |::.|::.||.:.|:|  .|.|....|.:.::.             |::||. :.:.
  Fly   134 --------YKVKGHVSALNLNGHG--KGYFEAENALLLLELAVKPLATSDGYFADVQSVK-VNFR 187

  Fly   169 HVKEFVLKIRTGKGNLKLENLFNGDKVLGDVINDTINQNFEVFTNDLIAPIARALEAKFLVITTK 233
            .:|:|         .:||||||.|:|.|.|..:...|:|:..|...|...:.:.:..   |:..:
  Fly   188 EIKQF---------RIKLENLFGGNKDLEDTAHILFNENWRDFFEVLRPAVEQTVGG---VLLDR 240

  Fly   234 ILENFTY 240
            ..:.|.|
  Fly   241 FKKTFVY 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:284096 58/260 (22%)
CG14258NP_651531.1 JHBP 13..255 CDD:284096 59/262 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1400525
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.