DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14661 and CG11854

Sequence 1:NP_001246918.1 Gene:CG14661 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_651358.4 Gene:CG11854 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster

Alignment Length:257 Identity:75/258 (29%)
Similarity:117/258 (45%) Gaps:18/258 (7%)


  Fly     1 MQFQLIVASLLICFVACISAGNMPDYIQVCHRNDPELSKCLKSSVH-NLRPYLAKGIKELNVPPL 64
            |:..|.:..|..|......|.:.|..|:.|...|   .:||:..|: .||.|...|||||.:.||
  Fly     1 MELTLALVLLFGCASTYGHASDFPSGIERCAIMD---EQCLEDRVNFVLRNYAKSGIKELGLIPL 62

  Fly    65 EPLYIGDLSI---LDGSAGLTVKAKKLNILGASNFEITKLRASTQNRRFDFELIL--PHLHGDGL 124
            :||::....|   ......:.:...:::|||.......::...|::.....||::  |.:...|.
  Fly    63 DPLHVKKFKIGRNPHSPVNIDLSFHEMDILGLHQGVAKRVSGFTRDLSRSIELVMEVPEIGVRGP 127

  Fly   125 YEINGNILALPIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLE---YLHVKEFVLKIRTGKGNLKL 186
            |.::|.||.|||.|||......|.  ..||.|..:|.|:..:   |..|....:::.......:|
  Fly   128 YSVDGRILILPITGNGIADIRLTR--TKVRAQIKLKRVSKGDHQTYAEVMNIKVELDPSHVTYQL 190

  Fly   187 ENLFNGDKVLGDVINDTINQNFEVFTNDLIAPIARA--LEAKFLVITTKILENFTYSELFPV 246
            ||||||.|.|.:.::..||:|::...|:|...|..|  |.||.:|  .:|.......:||.|
  Fly   191 ENLFNGQKDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVV--DRIFGKLPLEQLFVV 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:284096 72/246 (29%)
CG11854NP_651358.4 JHBP 21..249 CDD:214779 69/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1400077
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.