DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14661 and to

Sequence 1:NP_001246918.1 Gene:CG14661 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001287525.1 Gene:to FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster

Alignment Length:246 Identity:59/247 (24%)
Similarity:104/247 (42%) Gaps:11/247 (4%)


  Fly     6 IVASLLICFVACISAGNMPDYIQVCHRNDPELSKCLKSSVHNL-RPYLAKGIKELNVPPLEPLYI 69
            |..::::|.:..:.| ..|:..:.|...|.|   |:....:.| ....|:|...||:..|:||.:
  Fly     4 IAFAVVLCLLVSVDA-KFPEDPKPCKYGDGE---CIMKLCNTLFSENSAEGDPGLNLMQLDPLKV 64

  Fly    70 GDLSILDGSA----GLTVKAKKLNILGASNFEITKLRASTQN--RRFDFELILPHLHGDGLYEIN 128
            ..:.|..|.:    |:|:......:.|..:..|.|::...::  .:.:.:::.......|.|.|.
  Fly    65 DRMVISQGESSSPVGITLTFTDNLLYGIKDQRIVKVKGFGRDLTAKHEVKIVTKTFSLVGPYNIQ 129

  Fly   129 GNILALPIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTGKGNLKLENLFNGD 193
            |.:|.|||.|.|.......|..|.|.........|...||.|.:..:.::....:....||||||
  Fly   130 GKVLILPISGTGQSNMTMVNVRAIVSFSGKPLVKNGETYLDVTDLKITMKPESSHYHFSNLFNGD 194

  Fly   194 KVLGDVINDTINQNFEVFTNDLIAPIARALEAKFLVITTKILENFTYSELF 244
            |.|||.:|..:|:|.|....:....|.|:....:|.:...:.....|::.|
  Fly   195 KALGDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFF 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:284096 58/243 (24%)
toNP_001287525.1 JHBP 5..245 CDD:284096 57/244 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1400253
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.