DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14661 and CG15497

Sequence 1:NP_001246918.1 Gene:CG14661 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_650976.1 Gene:CG15497 FlyBaseID:FBgn0038894 Length:260 Species:Drosophila melanogaster

Alignment Length:238 Identity:51/239 (21%)
Similarity:98/239 (41%) Gaps:42/239 (18%)


  Fly    11 LICFVACIS-----AGNMPDYIQV----------CHRNDPELSKCLKSSVHNLRPYLAKGIKELN 60
            |:.::|.||     ..|....|.|          ||.:|.:.::|::...::||.|...|:.:.|
  Fly    12 LLVYLAGISLFANHLANASSQIDVDTDLKHLLGRCHWSDEDFNECMRQVFNDLRAYFTTGVPDYN 76

  Fly    61 VPPLEPLYIGDLSILDG-SAGL---TVKAKKLNILGASNFEITKLRASTQNRRFDFELILPHLHG 121
            :.|.:|.:...:.:..| |.||   .:..:.::..|.:..|:||..|..:::|..:....|....
  Fly    77 IKPFDPHHCSYVELRRGESQGLGSFRLILRNVSEYGWARSEVTKFHADPEDQRIVYTQYFPDKSL 141

  Fly   122 DGLYEINGNILALPIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKI-----RTGK 181
            :|.||....:|...:...|.:  |.|        .||......:..:.....::|:     |.|.
  Fly   142 EGEYEFAAKMLGTEMNRKGHW--NLT--------LYDYSQTTSVRRIGGPGSLIKVHVEVDRIGG 196

  Fly   182 GNLKLENLFNGDKVLGDVINDTINQNFEV-------FTNDLIA 217
            ..|.:|||..| :.|..:.:..||..:::       ..|:|::
  Fly   197 MELHIENLLQG-QPLNQLADGVINSMWQLGLPFIKPMINELVS 238

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:284096 51/239 (21%)
CG15497NP_650976.1 JHBP 26..258 CDD:284096 47/225 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1405883
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.