DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14661 and CG31189

Sequence 1:NP_001246918.1 Gene:CG14661 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_732580.3 Gene:CG31189 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster

Alignment Length:243 Identity:59/244 (24%)
Similarity:109/244 (45%) Gaps:18/244 (7%)


  Fly    13 CFVACISAGNMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELNVPPLEPLYIGDLSILD- 76
            |....||..::|:.::.||..|   |.||..|::.|..:..|||.|:.:|||:.....|..|:: 
  Fly    13 CIPVMISGASLPEDVEKCHFGD---STCLVRSINALIKHYPKGIPEIGLPPLDAYNFPDSVIMES 74

  Fly    77 ---GSAGLTVKAKKLNILGASNFEITKLRA---STQNRRFDFELILPHLHGDGLYEINGNILALP 135
               |...:..:.:.....|.:|..||.:..   ....::...::.||.|..:..|:::|.:|...
  Fly    75 PSRGPIWMDFRMRDNVNKGFNNATITHVEGFLYEPNQKQIVLKVRLPRLVHEATYDMSGRVLLFF 139

  Fly   136 IKGNGPFTGNFTNFVAYVRVQYDIKSV----NDLEYLHVKEFVLKIRTGKGNLKLENLFNGDKVL 196
            ....|....:|.||    |:...||::    ||..||.:...|..:...:..:.|:.|:..:..:
  Fly   140 FNTTGRLISDFQNF----RITLTIKALVEYRNDKRYLKIYNLVPSLDLDRWIIWLDGLYKENTDV 200

  Fly   197 GDVINDTINQNFEVFTNDLIAPIARALEAKFLVITTKILENFTYSELF 244
            ...:|...|:|:..|.|||...:.:|....|.|:..::.:|..|.::|
  Fly   201 TIFMNKLFNENWVEFWNDLQPGLVKAFTNAFTVLLNRVFDNVAYDDMF 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:284096 59/244 (24%)
CG31189NP_732580.3 JHBP 9..249 CDD:284096 59/244 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1400813
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.