DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14661 and CG10407

Sequence 1:NP_001246918.1 Gene:CG14661 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001303466.1 Gene:CG10407 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster

Alignment Length:233 Identity:65/234 (28%)
Similarity:115/234 (49%) Gaps:6/234 (3%)


  Fly    20 AGNMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELNVPPLEPLYIGDLSILDGSAGLTVK 84
            |..:|.:::|||||.|:|..|::.|...|||.|.:||.||.:|.:|||.:..:.:...|..:.:.
  Fly    31 ADQLPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAMEPLVVPQVKMDQDSGAIYLH 95

  Fly    85 A--KKLNILGASNFEITKLRASTQNRRFDFELILPHLHGDGLYEI----NGNILALPIKGNGPFT 143
            :  :.:.:.|.|...:.:||......:|...|..|.||.:..|.|    .|.|:.:|:.|:|...
  Fly    96 SVYRNVKVTGISKHTVNELRLEPSKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPLLGDGHCK 160

  Fly   144 GNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTGKGNLKLENLFNGDKVLGDVINDTINQNF 208
            .:..|......:.......|...:|.:....:|......::.|:|||||||.|||.:|:.:|:|:
  Fly   161 VDLVNITMRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALGDRMNEFLNENW 225

  Fly   209 EVFTNDLIAPIARALEAKFLVITTKILENFTYSELFPV 246
            :....::...:.:||.........|:..:|:|.:|.|:
  Fly   226 KALAEEVRPLMTKALVDILRASVDKLFASFSYDDLLPM 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:284096 64/231 (28%)
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 64/231 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1396486
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.