DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14661 and CG1124

Sequence 1:NP_001246918.1 Gene:CG14661 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_649509.1 Gene:CG1124 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster

Alignment Length:240 Identity:68/241 (28%)
Similarity:121/241 (50%) Gaps:7/241 (3%)


  Fly    12 ICFVACISAGNM-----PDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELNVPPLEPLYIGD 71
            :|.|..|.|..|     |.||:.||||||:|..|...::.:|:||||.||.::.:|.:||..:..
  Fly     5 VCLVIVIQALRMVQAETPPYIKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDIQLPSVEPFKMDT 69

  Fly    72 LS--ILDGSAGLTVKAKKLNILGASNFEITKLRASTQNRRFDFELILPHLHGDGLYEINGNILAL 134
            |:  :.:|..|..:..|.:...|||||::|.|:.|..:..|..::::|.|..:..|..:|.:|.|
  Fly    70 LALQLTEGPQGYKITLKNMEAFGASNFKVTSLKLSEGSEPFKAKIVMPKLKIEAKYTSSGVLLIL 134

  Fly   135 PIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTGKGNLKLENLFNGDKVLGDV 199
            |..|.|.|..||....|.:..:..|.:.....|||:....|.:......:.:...||.:::|.:.
  Fly   135 PASGGGDFHANFEGVSADLTGKTSIHAFKGANYLHIDALSLVLDVKDVKMSISGAFNNNRILLEA 199

  Fly   200 INDTINQNFEVFTNDLIAPIARALEAKFLVITTKILENFTYSELF 244
            .|..:.:|.:|....:.|.:.:.|.::|..:..::|:|....:.:
  Fly   200 TNLFLRENSQVVLEAMQAQLQKKLASEFGKLANQLLKNVPVEQFY 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:284096 68/241 (28%)
CG1124NP_649509.1 JHBP 6..244 CDD:284096 68/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1401696
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.