DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14661 and CG2016

Sequence 1:NP_001246918.1 Gene:CG14661 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001262270.1 Gene:CG2016 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster

Alignment Length:250 Identity:61/250 (24%)
Similarity:113/250 (45%) Gaps:29/250 (12%)


  Fly     1 MQFQLIVASLLICFVACISAGNMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELNVPPLE 65
            |.|.::||.|...|     |...|.|:|.|.|::.::::||:.|.:.|..||.||:.||::..:|
  Fly     5 MVFIVLVAVLGSTF-----AQEQPYYLQQCPRDEAQINECLRESGNKLVHYLQKGVPELDIYEIE 64

  Fly    66 PLYIGDLSILDGSA--GLTVKAKKLNILGASNFEITKLRASTQNRRFDFELILPHLHGDGLYEIN 128
            |:.|.::.|:.||.  |.....:.:...|.||..:|.:|:...:.:|.....:|.:.....|...
  Fly    65 PVMIDEIGIVLGSGPDGYRALFRNIQAYGVSNITVTNIRSDLDSLQFQLTCEIPRIRVKAQYRST 129

  Fly   129 GNILALPIKGNGPFTGNFTNFVAYVRVQYDIKSV-----NDLEYLHVKEFVLKIRTGKGNLKLEN 188
            |.::.:...|.|.:.|.:..    |:.:...|:|     :...||......:.....:..:.::|
  Fly   130 GVLILVKASGAGDYWGEYEG----VKAKIYFKAVANEGPDGRTYLTTDSVKMDFNVKEIQMGVDN 190

  Fly   189 LFNGDKVL-----GDVINDTINQNFEVFTNDLIAPIARALEAKFLVITTKILENF 238
            :.||:.|:     ...:|..||.|    :.:|:..:..||..|.    |.::.||
  Fly   191 IANGNTVILLSSTEAALNLFINSN----SQELLKEMKPALRTKL----TLVIRNF 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:284096 57/241 (24%)
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 60/248 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1401728
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.