DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14661 and CG14457

Sequence 1:NP_001246918.1 Gene:CG14661 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001014600.1 Gene:CG14457 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster

Alignment Length:256 Identity:60/257 (23%)
Similarity:104/257 (40%) Gaps:16/257 (6%)


  Fly     2 QFQLIVASLLICFVACISAG------NMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKEL- 59
            :.:|||  ||:.|..|:...      ..||||:.|...|.:...|...|:..|...|..||..| 
  Fly     3 RLELIV--LLVTFTTCLVRAEDGFLKEPPDYIKECRIADKDFVNCSTHSIQQLFDKLNDGIPGLT 65

  Fly    60 NVPPLEPLYIGDLSILDGSA---GLTVKAKKLNILGASNFEITKLRASTQNRRFDFELILPHLHG 121
            ::...:|.|:..:.|..|::   .|.|:...:.|:|..:..:...:...::..:.....||.:..
  Fly    66 SIRSFDPFYLNRIRITQGNSNAINLKVELANVKIIGFGHTNVLDSQVFKKDYSWKTTFTLPEMKL 130

  Fly   122 DGLYEINGNILALPIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTGKGNLKL 186
            ...|.:.|.||.:|:.|.|....:..|....:..:..:.|.....:.:|....:..:........
  Fly   131 QADYSLFGRILLIPLNGKGQVFLDAENMTVTMHTKTRLYSKGGFTFYNVTNLHVDFKMDGLKSYF 195

  Fly   187 ENLFNGDKVLGDVINDTINQNFEVFTNDLIAPIARALEAKFLVITTKILE----NFTYSEL 243
            .|||||:|.|.|..|...|.|:.:..:.|...|.:.:|...|.:..||..    ||..|::
  Fly   196 SNLFNGNKQLEDSTNKFFNDNWRMLADALYTVITQTIEDILLDVLKKIFHFIPANFFVSDI 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:284096 57/249 (23%)
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 59/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1400314
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.