DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14661 and CG5945

DIOPT Version :9

Sequence 1:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001260439.1 Gene:CG5945 / 34729 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster


Alignment Length:210 Identity:48/210 - (22%)
Similarity:83/210 - (39%) Gaps:41/210 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VASLLICFVACISAGNMPDY---IQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELNVPPLEPLY 68
            :..|.:..:.|.:|....:|   :..|...:.:|.:|:|...:.|.|.|..|..||.:.|.|||:
  Fly     5 IGLLSLLALGCSAAPTDKNYFADLPKCSTEEDQLGECVKQLFNTLTPRLKDGNPELRIEPYEPLH 69

  Fly    69 IGDLSI--LDGSAGLTVKAKKLNILGAS-----------NFEITKLRASTQNRRFDFELILPHLH 120
            :...|.  ..|:....:..:...|.|.|           |.:..|||..||         :|.|:
  Fly    70 LNRTSFQYSSGTVNGRITVRNAKIYGFSSNRAKEVSVKLNGDKVKLRLVTQ---------MPKLN 125

  Fly   121 GDGLYEINGNILALPIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTGKGNLK 185
            ..|.|:.:..:..|.:|..|.|  |.|              :.|:|.:.|.:..:..:.|....:
  Fly   126 IVGSYKADMQVNQLQLKPKGEF--NVT--------------LLDVEAITVTDGEVYEKDGHRFFR 174

  Fly   186 LENLFNGDKVLGDVI 200
            |:|:.:..|:...||
  Fly   175 LKNIDSKPKIKDLVI 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 48/207 (23%)
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 45/193 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470502
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.