DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and RAD6

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_011457.1 Gene:RAD6 SGDID:S000003026 Length:172 Species:Saccharomyces cerevisiae

Alignment Length:151 Identity:104/152 (68%)
Similarity:130/152 (86%) Gaps:0/152 (0%)


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65
            |||||||||||||||::||.|.|||.:|..:|:|:|||:|.||.|||:|||||:|.:||.|||||
Yeast     1 MSTPARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPN 65

  Fly    66 KPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLY 130
            |||.|:|:|::|||||||:|.||||||||||:|||||::||||||||.:||||.||||..||.|:
Yeast    66 KPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLF 130

  Fly   131 KENRREYEKRVKACVEQSFID 151
            |:::.:|.||||..||:|:.|
Yeast   131 KDHKSQYVKRVKETVEKSWED 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 93/137 (68%)
RAD6NP_011457.1 COG5078 1..150 CDD:227410 103/149 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5078
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 228 1.000 Inparanoid score I731
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001325
OrthoInspector 1 1.000 T1135690
orthoMCL 1 0.900 OOG5_127153
Panther 1 1.100 LDO PTHR24067
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1583
TreeFam 1 0.960
1110.860

Return to query results.
Submit another query.