DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and UBC13

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_010377.3 Gene:UBC13 / 851666 SGDID:S000002499 Length:153 Species:Saccharomyces cerevisiae


Alignment Length:140 Identity:54/140 - (38%)
Similarity:86/140 - (61%) Gaps:7/140 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVR 71
            :|::::.::|..||..|::..|.|:|:..:...|.||..:|:|||.|:|.:...::||.:.|.||
Yeast     6 KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVR 70

  Fly    72 FVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSP-ANSTAAQLYKENR- 134
            |::|::|||:...|.||||:|:..|||...:..:|.|||:||:.||||.| ||..|....|..: 
Yeast    71 FLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQG 135

  Fly   135 -----REYEK 139
                 ||:.|
Yeast   136 AKAKAREWTK 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 54/139 (39%)
UBC13NP_010377.3 UBCc 3..152 CDD:412187 54/140 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.