DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and UBC3

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_568956.1 Gene:UBC3 AraportID:AT5G62540 Length:150 Species:Arabidopsis thaliana

Alignment Length:150 Identity:108/150 (72%)
Similarity:133/150 (89%) Gaps:0/150 (0%)


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65
            |:|||::|||.||||||:|||.|:||||.|||||.|||:||||.|||::.||||||:.|||:|||
plant     1 MTTPAKKRLMWDFKRLQKDPPVGISGAPQDNNIMHWNALIFGPEDTPWDGGTFKLTLHFTEDYPN 65

  Fly    66 KPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLY 130
            |||.|||||::||||:||||.||||||||:|||.|||:|:||||||||.||||:||||:.||:|:
plant    66 KPPIVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAVLTSIQSLLCDPNPDSPANAEAARLF 130

  Fly   131 KENRREYEKRVKACVEQSFI 150
            .||:|||.::|...||||::
plant   131 SENKREYNRKVIEIVEQSYV 150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 100/137 (73%)
UBC3NP_568956.1 COG5078 1..148 CDD:227410 107/147 (73%)
UQ_con 8..145 CDD:278603 100/137 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H136588
Inparanoid 1 1.050 254 1.000 Inparanoid score I984
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1292821at2759
OrthoInspector 1 1.000 T125245
orthoMCL 1 0.900 OOG5_127153
Panther 1 1.100 O PTHR24067
Phylome 1 0.910 0.767 Consistency score
87.970

Return to query results.
Submit another query.