DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and Ube2b

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_006246405.1 Gene:Ube2b RGDID:708345 Length:180 Species:Rattus norvegicus

Alignment Length:151 Identity:130/152 (86%)
Similarity:140/152 (92%) Gaps:0/152 (0%)


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65
            |||||||||||||||||||||.||||||::||||.||||||||..||||||||||.|||:|||||
  Rat    29 MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPN 93

  Fly    66 KPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLY 130
            |||||||:||:|||||||||.|||||||||||||||||:|||||||||.:|||||||||.|||||
  Rat    94 KPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLY 158

  Fly   131 KENRREYEKRVKACVEQSFID 151
            :||:|||||||.|.||||:.|
  Rat   159 QENKREYEKRVSAIVEQSWND 179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 118/137 (86%)
Ube2bXP_006246405.1 COG5078 28..179 CDD:227410 129/150 (86%)
UQ_con 36..173 CDD:278603 118/137 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C205724500
eggNOG 1 0.900 E1_COG5078
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 274 1.000 Inparanoid score I2842
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001325
OrthoInspector 1 1.000 T617781
orthoMCL 1 0.900 OOG5_127153
Panther 1 1.100 O PTHR24067
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1110.760

Return to query results.
Submit another query.