DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and AT2G32790

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_565754.1 Gene:AT2G32790 AraportID:AT2G32790 Length:177 Species:Arabidopsis thaliana

Alignment Length:142 Identity:51/143 (36%)
Similarity:84/143 (59%) Gaps:5/143 (3%)


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGV---SGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEE 62
            :|..|..||.::|:  ::|....:   |..|:..||..|.|.:.||...|:|.|.|.:::....:
plant    26 VSKSAENRLWKEFQ--EKDDVLKIHVRSWLPSPENIFRWEATVNGPVGCPYEKGVFTVSVHIPPK 88

  Fly    63 YPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAA 127
            ||.:||.:.|.:|:||||:...|.|.:|||.:|||....::.:|.||.|:||:|......::.||
plant    89 YPYEPPKITFKTKIFHPNISEIGEIFVDILGSRWSSALTINLVLLSICSILSNPVEPLLVSNHAA 153

  Fly   128 QLYKENRREYEK 139
            :||:::|:.|||
plant   154 RLYQKDRKAYEK 165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 49/136 (36%)
AT2G32790NP_565754.1 COG5078 27..176 CDD:227410 51/142 (36%)
UQ_con 33..171 CDD:278603 49/136 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.