DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and AT2G32790

DIOPT Version :10

Sequence 1:NP_524230.2 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_565754.1 Gene:AT2G32790 / 817840 AraportID:AT2G32790 Length:177 Species:Arabidopsis thaliana


Alignment Length:142 Identity:51/142 - (35%)
Similarity:84/142 - (59%) Gaps:5/142 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGV---SGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEE 62
            :|..|..||.::|:  ::|....:   |..|:..||..|.|.:.||...|:|.|.|.:::....:
plant    26 VSKSAENRLWKEFQ--EKDDVLKIHVRSWLPSPENIFRWEATVNGPVGCPYEKGVFTVSVHIPPK 88

  Fly    63 YPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAA 127
            ||.:||.:.|.:|:||||:...|.|.:|||.:|||....::.:|.||.|:||:|......::.||
plant    89 YPYEPPKITFKTKIFHPNISEIGEIFVDILGSRWSSALTINLVLLSICSILSNPVEPLLVSNHAA 153

  Fly   128 QLYKENRREYEK 139
            :||:::|:.|||
plant   154 RLYQKDRKAYEK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_524230.2 UBCc_UBE2A_2B 3..145 CDD:467410 50/140 (36%)
AT2G32790NP_565754.1 UBCc_UEV 54..174 CDD:483950 44/112 (39%)

Return to query results.
Submit another query.