DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and UBC2

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001325162.1 Gene:UBC2 AraportID:AT2G02760 Length:152 Species:Arabidopsis thaliana

Alignment Length:149 Identity:113/150 (75%)
Similarity:137/150 (91%) Gaps:0/150 (0%)


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65
            ||||||:||||||||||:|||.|:||||.|||||:||||||||.|||::.|||||:::|:|:|||
plant     1 MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPN 65

  Fly    66 KPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLY 130
            |||||||||::||||:||||.||||||||:|||.|||:||||||||||.||||||||||.||:::
plant    66 KPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMF 130

  Fly   131 KENRREYEKRVKACVEQSF 149
            .|::|||.:||:..||||:
plant   131 SESKREYNRRVREVVEQSW 149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 103/137 (75%)
UBC2NP_001325162.1 UBCc 7..145 CDD:238117 103/138 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 254 1.000 Inparanoid score I984
OMA 1 1.010
OrthoDB 1 1.010 D1292821at2759
OrthoInspector 1 1.000 T125245
orthoMCL 1 0.900 OOG5_127153
Panther 1 1.100 LDO PTHR24067
Phylome 1 0.910 0.767 Consistency score
87.980

Return to query results.
Submit another query.