DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and ube2a

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_958430.1 Gene:ube2a ZFINID:ZDB-GENE-030616-72 Length:152 Species:Danio rerio

Alignment Length:151 Identity:133/152 (88%)
Similarity:142/152 (93%) Gaps:0/152 (0%)


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65
            |||||||||||||||||||||.||||||::||||:||||||||..||||||||||||||||||||
Zfish     1 MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPN 65

  Fly    66 KPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLY 130
            ||||||||||:|||||||||.|||||||||||||||||:|||||||||.:|||||||||.|||||
Zfish    66 KPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLY 130

  Fly   131 KENRREYEKRVKACVEQSFID 151
            :||:|||||||.|.||||:.|
Zfish   131 QENKREYEKRVSAIVEQSWRD 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 121/137 (88%)
ube2aNP_958430.1 UQ_con 8..145 CDD:333904 121/137 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5078
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 281 1.000 Inparanoid score I2812
OMA 1 1.010
OrthoDB 1 1.010 D1292821at2759
OrthoFinder 1 1.000 FOG0001325
OrthoInspector 1 1.000 T596410
orthoMCL 1 0.900 OOG5_127153
Panther 1 1.100 LDO PTHR24067
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1583
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.