DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and birc6

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_021328806.1 Gene:birc6 ZFINID:ZDB-GENE-091202-7 Length:4929 Species:Danio rerio

Alignment Length:173 Identity:53/174 (30%)
Similarity:81/174 (47%) Gaps:27/174 (16%)


  Fly     2 STPARRRLMRDFKRLQEDPPTGVSGAP----TDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEE 62
            |....|||.::...|....|...|.:.    .:..:.|...:|.||.|||:.:|.|:..:.|.::
Zfish  4643 SAARARRLAQEAVTLSTSLPLSSSSSVFVRCDEERLDIMKVLITGPADTPYANGCFEFDVYFPQD 4707

  Fly    63 YPNKPPTVRFV-----SKVFHPNVYADGGICLDIL-------QNRWSP-TYDVSAILTSIQSLL- 113
            |||.||.|...     |..|:||:|.||.:||.||       :.:|:| |.....:|.|||||: 
Zfish  4708 YPNSPPLVNLETTGGHSVRFNPNLYNDGKVCLSILNTWHGRPEEKWNPQTSSFLQVLVSIQSLIL 4772

  Fly   114 -SDPNPNSPA--NSTAAQLYKENRREYEKRVK------ACVEQ 147
             ::|..|.|.  .|.......::.|||:..::      |.:||
Zfish  4773 VAEPYFNEPGYERSRGTPSGTQSSREYDGNIRQATVKWAMLEQ 4815

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 49/164 (30%)
birc6XP_021328806.1 BIR 246..319 CDD:237989
BIRC6 3501..3664 CDD:315107
UBCc 4669..4807 CDD:238117 43/138 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.