DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and Ube2d4

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_112263.1 Gene:Ube2d4 RGDID:69425 Length:147 Species:Rattus norvegicus

Alignment Length:138 Identity:61/139 (44%)
Similarity:90/139 (65%) Gaps:0/139 (0%)


  Fly     5 ARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPT 69
            |.:|:.::...|.:|||...|..|...::..|.|.|.||:|:|::.|.|.|||:|..|||.|||.
  Rat     2 ALKRIHKELNDLAQDPPAQCSAGPVGEDMFHWQATIMGPNDSPYQGGAFFLTIDFPTEYPFKPPK 66

  Fly    70 VRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENR 134
            |.|.::::||||.::|.||||||:::|||...:|.:|.||.|||.||||:.|.....||:||.:|
  Rat    67 VEFTTRIYHPNVNSNGSICLDILRSQWSPALTISKVLLSISSLLCDPNPDDPLVPEIAQIYKTDR 131

  Fly   135 REYEKRVK 142
            .:|.:..:
  Rat   132 DKYNRTAR 139

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 60/136 (44%)
Ube2d4NP_112263.1 UBCc 1..146 CDD:350921 61/139 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.