DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and UBE2D3

DIOPT Version :10

Sequence 1:NP_524230.2 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_871622.1 Gene:UBE2D3 / 7323 HGNCID:12476 Length:149 Species:Homo sapiens


Alignment Length:134 Identity:58/134 - (43%)
Similarity:87/134 - (64%) Gaps:0/134 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTV 70
            |:.|.::...|..|||...|..|..:::..|.|.|.||:|:|::.|.|.|||.|..:||.|||.|
Human     5 RKCLSKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKV 69

  Fly    71 RFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRR 135
            .|.::::|||:.::|.||||||:::|||...:|.:|.||.|||.||||:.|.....|::||.:|.
Human    70 AFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRD 134

  Fly   136 EYEK 139
            :|.:
Human   135 KYNR 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_524230.2 UBCc_UBE2A_2B 3..145 CDD:467410 58/134 (43%)
UBE2D3NP_871622.1 UBCc_UBE2D 6..147 CDD:467412 57/133 (43%)

Return to query results.
Submit another query.