DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and flj11011l

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001038758.2 Gene:flj11011l ZFINID:ZDB-GENE-050113-1 Length:151 Species:Danio rerio

Alignment Length:145 Identity:47/146 (32%)
Similarity:67/146 (46%) Gaps:20/146 (14%)


  Fly     6 RRRLMRDFKRLQEDPPTG--VSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPP 68
            ::||.::...||.|||.|  ::.....|.|..|...:.|...|.:|...|:|..:|:..||:..|
Zfish     5 QKRLQKELLALQNDPPPGMTLNEKSVQNTITQWIVDMEGASGTVYEGEKFQLLFKFSSRYPSDSP 69

  Fly    69 TVRFVSK--VFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYK 131
            .|.|...  ..||:||::|.|||.||...|||...|.::..||.|:||.              .|
Zfish    70 QVMFTGDNIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSS--------------CK 120

  Fly   132 ENRREYEKR--VKAC 144
            |.||..:..  |:.|
Zfish   121 EKRRPPDNSFYVRTC 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 47/144 (33%)
flj11011lNP_001038758.2 UQ_con 7..148 CDD:278603 47/144 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.