DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and UBE2O

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_024306633.1 Gene:UBE2O HGNCID:29554 Length:1329 Species:Homo sapiens

Alignment Length:171 Identity:43/172 (25%)
Similarity:75/172 (44%) Gaps:35/172 (20%)


  Fly    13 FKRLQEDP---------------------PTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLT 56
            ||:::..|                     |.|:.....::.:.:::|:|.||..||:|||.:...
Human   978 FKKIEFQPPEAKKFFSTVRKEMALLATSLPEGIMVKTFEDRMDLFSALIKGPTRTPYEDGLYLFD 1042

  Fly    57 IEFTEEYPNKPPTVRFVSKV---FHPNVYADGGICLDIL-------QNRWSPTYDVSAILTSIQS 111
            |:....||..||...::|:.   .:||:|.:|.:|:.:|       ..||:....:..:|.|||.
Human  1043 IQLPNIYPAVPPHFCYLSQCSGRLNPNLYDNGKVCVSLLGTWIGKGTERWTSKSSLLQVLISIQG 1107

  Fly   112 LL--SDPNPNSPANSTAAQLYK--ENRREYEKRVKACVEQS 148
            |:  ::|..|.....:...|.:  ||.|.|.:.....|.||
Human  1108 LILVNEPYYNEAGFDSDRGLQEGYENSRCYNEMALIRVVQS 1148

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 40/167 (24%)
UBE2OXP_024306633.1 UBCc 995..1145 CDD:238117 37/150 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.