DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and UBE2R2

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_060281.2 Gene:UBE2R2 HGNCID:19907 Length:238 Species:Homo sapiens

Alignment Length:165 Identity:62/166 (37%)
Similarity:94/166 (57%) Gaps:24/166 (14%)


  Fly     3 TPARRRLMRDFKRLQEDPPTGVSGAPTD-NNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNK 66
            |.:::.||.:.|.|||:|..|......| :::..|...||||.:|.:|.|.||..|:|..:||..
Human     7 TSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYS 71

  Fly    67 PPTVRFVSKVFHPNVYADGGICLDIL-------------QNRWSPTYDVSAILTSIQSLLSDPNP 118
            |||.||::|::|||:|.:|.:|:.||             ..||:||.:|..||.|:.|||::||.
Human    72 PPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNT 136

  Fly   119 NSPANSTAAQLYKENR------REY----EKRVKA 143
            .||||..|:.::::.|      :||    .|:|.|
Human   137 FSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSA 171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 61/161 (38%)
UBE2R2NP_060281.2 UBCc 11..169 CDD:238117 59/158 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.