DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and ube2i

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001016408.1 Gene:ube2i XenbaseID:XB-GENE-974017 Length:158 Species:Xenopus tropicalis

Alignment Length:150 Identity:64/150 (43%)
Similarity:85/150 (57%) Gaps:7/150 (5%)


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDN-----NIMIWNAVIFGPHDTPFEDGTFKLTIEFT 60
            ||..|..||.::.|..::|.|.|....||.|     |:|.|...|.|...||:|.|.|||.:.|.
 Frog     1 MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFK 65

  Fly    61 EEYPNKPPTVRFVSKVFHPNVYADGGICLDILQ--NRWSPTYDVSAILTSIQSLLSDPNPNSPAN 123
            ::||:.||..:|...:||||||..|.:||.||:  ..|.|...:..||..||.||::||...||.
 Frog    66 DDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQ 130

  Fly   124 STAAQLYKENRREYEKRVKA 143
            :.|..:|.:||.||||||:|
 Frog   131 AEAYTIYCQNRVEYEKRVRA 150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 61/143 (43%)
ube2iNP_001016408.1 UQ_con 8..152 CDD:333904 61/143 (43%)
Interaction with sumo1. {ECO:0000250} 13..18 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.