DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and vih

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_648582.1 Gene:vih FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster

Alignment Length:141 Identity:58/142 (41%)
Similarity:85/142 (60%) Gaps:1/142 (1%)


  Fly     7 RRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVR 71
            :||.::...|......|:|..|...||..|...|.||.:|.:...|::|:::|...||...|.|:
  Fly    35 KRLHKELMNLMMANERGISAFPDGENIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYPYAAPVVK 99

  Fly    72 FVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRRE 136
            |::..|||||...|.||||||:::||..|||..||.||||||.:||..||.|:.||.::.: ::|
  Fly   100 FLTSCFHPNVDLQGAICLDILKDKWSALYDVRTILLSIQSLLGEPNNESPLNAQAAMMWND-QKE 163

  Fly   137 YEKRVKACVEQ 147
            |:|.:.|..|:
  Fly   164 YKKYLDAFYEK 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 57/137 (42%)
vihNP_648582.1 COG5078 31..166 CDD:227410 55/132 (42%)
UQ_con 36..172 CDD:278603 57/137 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124456025
eggNOG 1 0.900 E1_COG5078
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.