DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and CG5823

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster


Alignment Length:170 Identity:43/170 - (25%)
Similarity:79/170 - (46%) Gaps:30/170 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRF 72
            |:.:|:.||:.||...::..|..|||:.|:..:.||.|:|:..|.:..|:.|..|:|.|||::..
  Fly    18 RMKQDYMRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFPFKPPSIYM 82

  Fly    73 VSKVFHPN--VYADGGICL---DILQNRWSPTYDVSAILTSIQSLLSDPNPN------------- 119
            ::    ||  ...:..:||   |...:.|:||:.|..|||.:.|.:.:..|.             
  Fly    83 LT----PNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLESTPTLGSIESSNYDKQM 143

  Fly   120 --------SPANSTAAQLYKENRREYEKRVKACVEQSFID 151
                    :..|:...:|:.|...|.::|::.....:.:|
  Fly   144 FAQKSLAFNLRNTNFCELFPEIVEEIKQRLRGTQAAAAVD 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 42/162 (26%)
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 36/114 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.