DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and CG5823

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001262669.1 Gene:CG5823 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster

Alignment Length:170 Identity:43/171 (25%)
Similarity:79/171 (46%) Gaps:30/171 (18%)


  Fly     8 RLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRF 72
            |:.:|:.||:.||...::..|..|||:.|:..:.||.|:|:..|.:..|:.|..|:|.|||::..
  Fly    18 RMKQDYMRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFPFKPPSIYM 82

  Fly    73 VSKVFHPN--VYADGGICL---DILQNRWSPTYDVSAILTSIQSLLSDPNPN------------- 119
            ::    ||  ...:..:||   |...:.|:||:.|..|||.:.|.:.:..|.             
  Fly    83 LT----PNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLESTPTLGSIESSNYDKQM 143

  Fly   120 --------SPANSTAAQLYKENRREYEKRVKACVEQSFID 151
                    :..|:...:|:.|...|.::|::.....:.:|
  Fly   144 FAQKSLAFNLRNTNFCELFPEIVEEIKQRLRGTQAAAAVD 183

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 42/163 (26%)
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 36/115 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124452291
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.