DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and CG14739

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_650151.1 Gene:CG14739 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster

Alignment Length:146 Identity:48/147 (33%)
Similarity:79/147 (54%) Gaps:10/147 (7%)


  Fly     5 ARRRLMRDFKRLQEDPPTGVSGAPT--DNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKP 67
            |.|||.||..||.      .||..|  |:::...|..:.||..:.:|.|.:.:.:...::||...
  Fly    14 AGRRLDRDVNRLL------ASGYRTTVDDDMTNLNVCLEGPLGSAYEGGIWTVNVTMPQDYPLTA 72

  Fly    68 PTVRFVSKVFHPNV-YADGGICLDILQNRWSPTYD-VSAILTSIQSLLSDPNPNSPANSTAAQLY 130
            |.||||:|:.|||: :..|.:|:::|:..||.:|| |:...|.:..||..|||:...|..||.:.
  Fly    73 PRVRFVTKILHPNIEFITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSLNHRAAAIM 137

  Fly   131 KENRREYEKRVKACVE 146
            |.:.:.:.:.|..|::
  Fly   138 KHSEQLFREHVILCMK 153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 46/141 (33%)
CG14739NP_650151.1 UQ_con 17..152 CDD:278603 46/141 (33%)
COG5078 12..157 CDD:227410 48/147 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124455568
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.