DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and ube2j1

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_999932.1 Gene:ube2j1 / 406794 ZFINID:ZDB-GENE-040426-2853 Length:314 Species:Danio rerio


Alignment Length:151 Identity:40/151 - (26%)
Similarity:69/151 - (45%) Gaps:12/151 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65
            :.:||.:|||::...|: ||.......|.::|:..|:..:.||.|:.|:.|.:...|....|||.
Zfish     7 LKSPAVKRLMKEAAELR-DPTEHYHAQPLEDNLFEWHFSVRGPPDSDFDGGVYHGRIVLPPEYPM 70

  Fly    66 KPPTVRFVSKVFHPNVYADGG--ICLDILQNR---WSPTYDVSAILTSIQSLLSDPNPNSPANST 125
            |||::..::    ||...:.|  |||.|..:.   |.|::.:...|.:|...:  |.....|..:
Zfish    71 KPPSIILLT----PNGRFEVGKKICLSISGHHPETWQPSWSIRTALIAIIGFM--PTKGEGAIGS 129

  Fly   126 AAQLYKENRREYEKRVKACVE 146
            .....:|.:...:|....|.|
Zfish   130 LDYTPEERKALAKKSQDFCCE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 36/141 (26%)
ube2j1NP_999932.1 UBCc 12..152 CDD:238117 38/146 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.