DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and CG7656

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_648783.4 Gene:CG7656 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster

Alignment Length:161 Identity:62/162 (38%)
Similarity:91/162 (56%) Gaps:20/162 (12%)


  Fly     2 STPARRRLMRDFKRLQEDPPTGVS-GAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65
            |:.|.|.|..::|.|||:|..|.. ....|:|:..|...||||.||.::.|.||..::|..:||.
  Fly    38 SSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPY 102

  Fly    66 KPPTVRFVSKVFHPNVYADGGICLDILQ-------------NRWSPTYDVSAILTSIQSLLSDPN 117
            .||::||::||:|||||.:|.:|:.||.             .||:||.:|..||.|:.|||::||
  Fly   103 SPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPN 167

  Fly   118 PNSPANSTAAQLYKENR------REYEKRVK 142
            ..||||..|:.:|:..|      .||...::
  Fly   168 TFSPANVDASVMYRRWRDSQGKDNEYPNIIR 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 59/156 (38%)
CG7656NP_648783.4 UBCc 42..186 CDD:238117 58/144 (40%)
COG5078 45..182 CDD:227410 56/137 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124454244
eggNOG 1 0.900 E1_COG5078
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24067
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.