DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and CG16894

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_611455.1 Gene:CG16894 FlyBaseID:FBgn0034483 Length:266 Species:Drosophila melanogaster

Alignment Length:140 Identity:37/141 (26%)
Similarity:58/141 (41%) Gaps:35/141 (25%)


  Fly    36 WNAVIFGPHDTPFEDGTFKLTIEFTEEYPN--KPPTVRFVSKVFHPNVYADGGIC-----LDILQ 93
            |..||| .|...:....|:.:|...|.:|.  ..|||.|.::|.||:      ||     ||:..
  Fly    46 WFGVIF-VHSGIYAGSVFRFSILLPENFPADISLPTVVFSTEVLHPH------ICPQNKTLDLAH 103

  Fly    94 --NRW-SPTYDVSAILTSIQSLLSDPN---------------PNSPANSTAAQLYKENRREYEKR 140
              |.| ...:.:..:|..||::.:||.               .:...|..|..:..::|.||.||
  Fly   104 FLNEWRKDEHHIWHVLRYIQAIFADPEGSICTGQSSSGDLVIMDEVRNMNALNMLAKSRPEYIKR 168

  Fly   141 VKACVEQSFI 150
            |:   ||:.:
  Fly   169 VQ---EQAIL 175

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 35/134 (26%)
CG16894NP_611455.1 COG5078 20..176 CDD:227410 37/141 (26%)
UBCc 23..173 CDD:294101 37/137 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124451493
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.