DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and CG16894

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_611455.1 Gene:CG16894 / 37280 FlyBaseID:FBgn0034483 Length:266 Species:Drosophila melanogaster


Alignment Length:140 Identity:37/140 - (26%)
Similarity:58/140 - (41%) Gaps:35/140 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 WNAVIFGPHDTPFEDGTFKLTIEFTEEYPN--KPPTVRFVSKVFHPNVYADGGIC-----LDILQ 93
            |..||| .|...:....|:.:|...|.:|.  ..|||.|.::|.||:      ||     ||:..
  Fly    46 WFGVIF-VHSGIYAGSVFRFSILLPENFPADISLPTVVFSTEVLHPH------ICPQNKTLDLAH 103

  Fly    94 --NRW-SPTYDVSAILTSIQSLLSDPN---------------PNSPANSTAAQLYKENRREYEKR 140
              |.| ...:.:..:|..||::.:||.               .:...|..|..:..::|.||.||
  Fly   104 FLNEWRKDEHHIWHVLRYIQAIFADPEGSICTGQSSSGDLVIMDEVRNMNALNMLAKSRPEYIKR 168

  Fly   141 VKACVEQSFI 150
            |:   ||:.:
  Fly   169 VQ---EQAIL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 35/133 (26%)
CG16894NP_611455.1 COG5078 20..176 CDD:227410 37/140 (26%)
UBCc 23..173 CDD:294101 36/136 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438067
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24067
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.