DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and Ubc10

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_477414.1 Gene:Ubc10 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster

Alignment Length:152 Identity:40/153 (26%)
Similarity:77/153 (50%) Gaps:21/153 (14%)


  Fly     1 MSTPARRR---------LMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLT 56
            |:.|.|.|         .::.|:.::.|          |:|::.|..:|. |.:.|:..|.|::.
  Fly     1 MTAPRRLRKELSDLQGNALKSFRDIKAD----------DDNLLRWTGLIV-PDNPPYNKGAFRIE 54

  Fly    57 IEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQ-NRWSPTYDVSAILTSIQSLLSDPNPNS 120
            |.|..|||.|||.:.|.::::|||:...|.:||.|:. ..|.|......::.::..|::||.|..
  Fly    55 INFPAEYPFKPPKINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEH 119

  Fly   121 PANSTAAQLYKENRREYEKRVK 142
            |..:..|:.:.::|:::.|..:
  Fly   120 PLRAELAEEFLKDRKKFVKNAE 141

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 37/146 (25%)
Ubc10NP_477414.1 COG5078 1..150 CDD:227410 40/153 (26%)
UQ_con 6..144 CDD:278603 38/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5078
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.