DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and CG3473

DIOPT Version :10

Sequence 1:NP_524230.2 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster


Alignment Length:142 Identity:62/142 - (43%)
Similarity:92/142 - (64%) Gaps:3/142 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKP 67
            ||   |::::.:||.|||..|:|..|.:.|...::.::.||.|:|||.|.|||.:...|:||.|.
  Fly     5 TP---RIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKA 66

  Fly    68 PTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKE 132
            |.|||::|:||||:...|.||||||:::|||...:..:|.|||:|||.|||:.|..:..|:|:|.
  Fly    67 PKVRFLTKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKV 131

  Fly   133 NRREYEKRVKAC 144
            |.|...:..:.|
  Fly   132 NERRAIQLAREC 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_524230.2 UBCc_UBE2A_2B 3..145 CDD:467410 62/142 (44%)
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 62/142 (44%)

Return to query results.
Submit another query.