DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and CG3473

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001285937.1 Gene:CG3473 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster

Alignment Length:142 Identity:62/143 (43%)
Similarity:92/143 (64%) Gaps:3/143 (2%)


  Fly     3 TPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKP 67
            ||   |::::.:||.|||..|:|..|.:.|...::.::.||.|:|||.|.|||.:...|:||.|.
  Fly     5 TP---RIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKA 66

  Fly    68 PTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKE 132
            |.|||::|:||||:...|.||||||:::|||...:..:|.|||:|||.|||:.|..:..|:|:|.
  Fly    67 PKVRFLTKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKV 131

  Fly   133 NRREYEKRVKAC 144
            |.|...:..:.|
  Fly   132 NERRAIQLAREC 143

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 60/138 (43%)
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 62/143 (43%)
COG5078 7..149 CDD:227410 60/138 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124450139
eggNOG 1 0.900 E1_COG5078
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.