DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and lwr

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001259833.1 Gene:lwr FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster

Alignment Length:150 Identity:62/150 (41%)
Similarity:83/150 (55%) Gaps:7/150 (5%)


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDN-----NIMIWNAVIFGPHDTPFEDGTFKLTIEFT 60
            ||..|..||..:.|..::|.|.|....|..|     |:|||...|.|...||:|.|.:||.:.|.
  Fly     1 MSGIAITRLGEERKAWRKDHPFGFVARPAKNPDGTLNLMIWECAIPGKKSTPWEGGLYKLRMIFK 65

  Fly    61 EEYPNKPPTVRFVSKVFHPNVYADGGICLDIL--QNRWSPTYDVSAILTSIQSLLSDPNPNSPAN 123
            ::||..||..:|...:||||||..|.:||.:|  :..|.|...:..||..||.||::||...||.
  Fly    66 DDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNIKDPAQ 130

  Fly   124 STAAQLYKENRREYEKRVKA 143
            :.|..:|.:||.||||||:|
  Fly   131 AEAYTIYCQNRLEYEKRVRA 150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 59/143 (41%)
lwrNP_001259833.1 UQ_con 8..152 CDD:306648 59/143 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124456153
eggNOG 1 0.900 E1_COG5078
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24067
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.