DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and CG2574

DIOPT Version :10

Sequence 1:NP_524230.2 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster


Alignment Length:132 Identity:48/132 - (36%)
Similarity:79/132 - (59%) Gaps:0/132 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRF 72
            |:..:.:.::::||...:......:::.|.|.:.||..:.:|.|.|:|.|.|...||.:.|.:||
  Fly    66 RIKSELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRF 130

  Fly    73 VSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREY 137
            .::::|.||.:.|.||||:|..||||..:|:.:|.||..|:|:.||:.|.....|..||.||||:
  Fly   131 TTRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREH 195

  Fly   138 EK 139
            :|
  Fly   196 DK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_524230.2 UBCc_UBE2A_2B 3..145 CDD:467410 48/132 (36%)
CG2574NP_572796.1 UBCc_UEV 66..204 CDD:483950 48/132 (36%)

Return to query results.
Submit another query.