DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and UBE2K

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_005330.1 Gene:UBE2K HGNCID:4914 Length:200 Species:Homo sapiens

Alignment Length:146 Identity:50/147 (34%)
Similarity:84/147 (57%) Gaps:4/147 (3%)


  Fly     1 MSTPARRRLMRDFKRL---QEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEE 62
            |:..|.:|:.|:||.:   :|.....:.....|.|.......|.||.|||:|.|.::|.|:..|.
Human     1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPET 65

  Fly    63 YPNKPPTVRFVSKVFHPNVYA-DGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTA 126
            ||..||.|||::|::|||:.: .|.||||||:::|:....:..:|.|:|:||:...|:.|.::..
Human    66 YPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVV 130

  Fly   127 AQLYKENRREYEKRVK 142
            |..||:|...:::..:
Human   131 ANQYKQNPEMFKQTAR 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 48/140 (34%)
UBE2KNP_005330.1 UQ_con 8..149 CDD:333904 48/140 (34%)
UBA_II_E2_UBE2K 163..200 CDD:270573
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.