powered by:
Protein Alignment Ubc6 and Ube2s
DIOPT Version :9
| Sequence 1: | NP_001246916.1 |
Gene: | Ubc6 / 40610 |
FlyBaseID: | FBgn0004436 |
Length: | 151 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001099694.1 |
Gene: | Ube2s / 292588 |
RGDID: | 1564746 |
Length: | 223 |
Species: | Rattus norvegicus |
| Alignment Length: | 140 |
Identity: | 46/140 - (32%) |
| Similarity: | 75/140 - (53%) |
Gaps: | 0/140 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 RRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVR 71
|.:.::...|..|||.|:...|.:.::......|.||..||:..|.|::.:...:::|..||...
Rat 14 RLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGY 78
Fly 72 FVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRRE 136
|::|:|||||..:|.||:::|:..|:....:..:|.:|:.||..|||.|..|..|.:|..||..|
Rat 79 FLTKIFHPNVGPNGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEE 143
Fly 137 YEKRVKACVE 146
|..|.:...|
Rat 144 YAARARLLTE 153
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.