DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and rhp6

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_592876.1 Gene:rhp6 PomBaseID:SPAC18B11.07c Length:151 Species:Schizosaccharomyces pombe

Alignment Length:149 Identity:107/150 (71%)
Similarity:129/150 (86%) Gaps:0/150 (0%)


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65
            |||.|||||||||||:|:|||.|||.:|..:|:|:|||||.||.|||||||||||.:.|.|:|||
pombe     1 MSTTARRRLMRDFKRMQQDPPAGVSASPVSDNVMLWNAVIIGPADTPFEDGTFKLVLSFDEQYPN 65

  Fly    66 KPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLY 130
            |||.|:|||.:|||||||:|.:|||||||||||||||:||||||||||:|||..||||:.||||:
pombe    66 KPPLVKFVSTMFHPNVYANGELCLDILQNRWSPTYDVAAILTSIQSLLNDPNNASPANAEAAQLH 130

  Fly   131 KENRREYEKRVKACVEQSF 149
            :||::||.:||:..||.|:
pombe   131 RENKKEYVRRVRKTVEDSW 149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 98/137 (72%)
rhp6NP_592876.1 COG5078 1..150 CDD:227410 107/150 (71%)
UQ_con 8..145 CDD:278603 98/137 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I832
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001325
OrthoInspector 1 1.000 T1124440
orthoMCL 1 0.900 OOG5_127153
Panther 1 1.100 LDO PTHR24067
Phylome 1 0.910 0.744 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1583
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.