DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and ubc-21

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_509502.3 Gene:ubc-21 WormBaseID:WBGene00006716 Length:214 Species:Caenorhabditis elegans

Alignment Length:137 Identity:45/138 (33%)
Similarity:79/138 (57%) Gaps:4/138 (3%)


  Fly     1 MSTPARRRLMRDFKRL---QEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEE 62
            ||..|..|:.|..|.:   .:....|:.....:||:|.....|.||..||:..|||::.::..|.
 Worm    15 MSNLALARVTRKCKEVANASDITEAGIHVEIKENNLMDIKGFIKGPEGTPYAGGTFEIKVDIPEH 79

  Fly    63 YPNKPPTVRFVSKVFHPNVYAD-GGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTA 126
            ||.:||..:||::::|||:.:. |.||||||:::|:.:..:..:|.|:|::|..|.|:.|.::..
 Worm    80 YPFEPPKAKFVTRIWHPNISSQTGTICLDILKDKWTASLTLRTVLLSLQAMLCSPEPSDPQDAVV 144

  Fly   127 AQLYKEN 133
            |:.:..|
 Worm   145 AKQFINN 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 42/131 (32%)
ubc-21NP_509502.3 COG5078 15..167 CDD:227410 45/138 (33%)
UQ_con 25..163 CDD:278603 41/128 (32%)
UBA_II_E2_UBE2K_like 178..213 CDD:270498
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.