DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and ubc-1

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_500480.1 Gene:ubc-1 WormBaseID:WBGene00006701 Length:192 Species:Caenorhabditis elegans

Alignment Length:151 Identity:122/152 (80%)
Similarity:142/152 (93%) Gaps:0/152 (0%)


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65
            |:||:|||||||||:||||||.|||||||::||:.|.|:||||.:||||||||||::||||||||
 Worm     1 MTTPSRRRLMRDFKKLQEDPPAGVSGAPTEDNILTWEAIIFGPQETPFEDGTFKLSLEFTEEYPN 65

  Fly    66 KPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLY 130
            |||||:|:||:|||||||||.||||||||||||||||:||||||||||.:|||||||||.|||||
 Worm    66 KPPTVKFISKMFHPNVYADGSICLDILQNRWSPTYDVAAILTSIQSLLDEPNPNSPANSLAAQLY 130

  Fly   131 KENRREYEKRVKACVEQSFID 151
            :||||||||||:..||||:::
 Worm   131 QENRREYEKRVQQIVEQSWLN 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 113/137 (82%)
ubc-1NP_500480.1 COG5078 1..149 CDD:227410 122/148 (82%)
UQ_con 8..145 CDD:278603 113/137 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5078
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 269 1.000 Inparanoid score I1822
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1292821at2759
OrthoFinder 1 1.000 FOG0001325
OrthoInspector 1 1.000 T476158
orthoMCL 1 0.900 OOG5_127153
Panther 1 1.100 LDO PTHR24067
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1583
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.