DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc6 and Birc6

Sequence 1:NP_001246916.1 Gene:Ubc6 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_006523581.1 Gene:Birc6 MGIID:1276108 Length:4953 Species:Mus musculus

Alignment Length:173 Identity:51/174 (29%)
Similarity:81/174 (47%) Gaps:27/174 (16%)


  Fly     2 STPARRRLMRDFKRLQEDPPTGVSGAP----TDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEE 62
            |....|||.::...|....|...|.:.    .:..:.|...:|.||.|||:.:|.|:..:.|.::
Mouse  4667 SAARARRLAQEAVTLSTSLPLSSSSSVFVRCDEERLDIMKVLITGPADTPYANGCFEFDVYFPQD 4731

  Fly    63 YPNKPPTVRFV-----SKVFHPNVYADGGICLDIL-------QNRWSP-TYDVSAILTSIQSLL- 113
            ||:.||.|...     |..|:||:|.||.:||.||       :.:|:| |.....:|.|:|||: 
Mouse  4732 YPSSPPLVNLETTGGHSVRFNPNLYNDGKVCLSILNTWHGRPEEKWNPQTSSFLQVLVSVQSLIL 4796

  Fly   114 -SDPNPNSPA--NSTAAQLYKENRREYEKRVK------ACVEQ 147
             ::|..|.|.  .|.......::.|||:..::      |.:||
Mouse  4797 VAEPYFNEPGYERSRGTPSGTQSSREYDGNIRQATVKWAMLEQ 4839

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:306648 47/164 (29%)
Birc6XP_006523581.1 BIR 347..420 CDD:237989
DUF3643 3560..3712 CDD:289152
UBCc 4693..4831 CDD:238117 41/138 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.