DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hus1-like and AT1G52530

DIOPT Version :8

Sequence 1:NP_001262267.1 Gene:Hus1-like / 40598 FlyBaseID:FBgn0026417 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001321342.1 Gene:AT1G52530 / 841684 AraportID:AT1G52530 Length:319 Species:Arabidopsis thaliana

Alignment Length:314 Identity:67/315 (21%)
Similarity:127/315 (40%) Gaps:63/315 (20%)


  Fly     1 MKFRALMQD---PLYMKEFQAIVATLTKLAKDCVMILGSRQMHFIVNEDQSSAASPLVWAGITAE 62
            |||:|.:.:   .|..|.|   :....|:.|:|.::|....:.|:.|.........:  |....:
plant     1 MKFKAFLTENGVNLLEKRF---LPAFDKMGKNCHLLLTKEHLFFLHNLLNGDGVQCI--AQFRKD 60

  Fly    63 EYFPEYRMEAAHPDQEYIVLGVSSANLGRA----LSVLR--GGGVNSCKLKLQRI-QFP--CISV 118
            ..|.:||:.:.:.|:  |...:..|.|.||    :|:..  .||:.|.:|:::.: :.|  |...
plant    61 VLFDDYRISSQNEDR--IAFSLDVALLYRAVKSSVSICTEFSGGLASNRLQIKLVKKLPPNCTQP 123

  Fly   119 IASVLTSSSTEAREVVHDVPVTIIPGSDWSAYVVPRVPNSQLALGL-----PSL------RLLKS 172
            :..:...:......|:.|||:|       ......:|...|.||..     |:|      ..|::
plant   124 MPFLTFETKGYKSAVIQDVPIT-------KPLSRSQVIELQTALDSAQDLPPTLVQVQDSNQLQN 181

  Fly   173 LIDKLKNISPSLEFQVNVDGELNVIATSEMSTVTSRFQKLLIRTVSGSQQEASCSVDSRKASAFF 237
            .:|.::::...|...::..|:|.|..::.:..:...||:|   :|.|.:.:|  .|:.|..||  
plant   182 FVDHMRHVGDVLNVTISKHGDLQVQVSTTLIRLGIEFQRL---SVIGEKSQA--PVEDRNLSA-- 239

  Fly   238 GALQLPNEELTIGIDREHSIHLQIDVRQ------------DVVLHSILP-AVCM 278
               |..:|.   .|.|..:..:|:.|:.            |...:.|.| ..|:
plant   240 ---QARSER---AIARGDAQSVQVSVKHFSKSLQCHLTKPDSTFYGIAPQGACL 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hus1-likeNP_001262267.1 Hus1 1..277 CDD:281934 66/312 (21%)
AT1G52530NP_001321342.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1053181at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12900
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.