powered by:
Protein Alignment Hus1-like and LTO1
DIOPT Version :9
| Sequence 1: | NP_001262267.1 |
Gene: | Hus1-like / 40598 |
FlyBaseID: | FBgn0026417 |
Length: | 278 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001334465.1 |
Gene: | LTO1 / 72284 |
MGIID: | 1919534 |
Length: | 161 |
Species: | Mus musculus |
| Alignment Length: | 44 |
Identity: | 14/44 - (31%) |
| Similarity: | 19/44 - (43%) |
Gaps: | 11/44 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 8 QDPLYMKEFQAIVA----------TLTKLAKDCVMILGS-RQMH 40
:|...||..:|::| |..||.:|...|.|. ||.|
Mouse 88 KDSRKMKVVEALIALLQDFPYDDPTYEKLHEDLDRIRGKFRQYH 131
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| Hus1-like | NP_001262267.1 |
Hus1 |
1..277 |
CDD:281934 |
14/44 (32%) |
| LTO1 | NP_001334465.1 |
None |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
O |
PTHR12900 |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.