DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hus1-like and LTO1

DIOPT Version :10

Sequence 1:NP_477426.1 Gene:Hus1-like / 40598 FlyBaseID:FBgn0026417 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001334465.2 Gene:LTO1 / 72284 MGIID:1919534 Length:147 Species:Mus musculus


Alignment Length:44 Identity:14/44 - (31%)
Similarity:19/44 - (43%) Gaps:11/44 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QDPLYMKEFQAIVA----------TLTKLAKDCVMILGS-RQMH 40
            :|...||..:|::|          |..||.:|...|.|. ||.|
Mouse    74 KDSRKMKVVEALIALLQDFPYDDPTYEKLHEDLDRIRGKFRQYH 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hus1-likeNP_477426.1 Hus1 1..276 CDD:461127 14/44 (32%)
LTO1NP_001334465.2 Yae1_N 22..60 CDD:430844
deca-GX3 motif, required for interaction with YAE1 and the CIA complex. /evidence=ECO:0000250|UniProtKB:P53846 22..58
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.