powered by:
Protein Alignment Hus1-like and lto1
DIOPT Version :8
Sequence 1: | NP_001262267.1 |
Gene: | Hus1-like / 40598 |
FlyBaseID: | FBgn0026417 |
Length: | 278 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001077021.1 |
Gene: | lto1 / 563810 |
ZFINID: | ZDB-GENE-030729-33 |
Length: | 141 |
Species: | Danio rerio |
Alignment Length: | 44 |
Identity: | 10/45 (22%) |
Similarity: | 16/45 (36%) |
Gaps: | 10/45 (22%) |
Fly 8 QDPLYMKEFQAIVATLTKLAKDCVM----------ILGSRQMHF 41
:||.|.|..:.:.....|..:.|.: :.||..|.|
Zfish 98 EDPQYEKLQEDMERVRAKFRQVCSLLNVSTDFREYLSGSTSMSF 141
|
Known Domains:
Gene | Sequence | Domain | Region |
External ID | Identity |
Hus1-like | NP_001262267.1 |
Hus1 |
1..277 |
CDD:281934 |
10/45 (22%) |
lto1 | NP_001077021.1 |
Yae1_N |
25..63 |
CDD:286849 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
|
|
O |
PTHR12900 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.