powered by:
                   
 
    
    
             
          
            Protein Alignment Hus1-like and lto1
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001262267.1 | Gene: | Hus1-like / 40598 | FlyBaseID: | FBgn0026417 | Length: | 278 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001077021.1 | Gene: | lto1 / 563810 | ZFINID: | ZDB-GENE-030729-33 | Length: | 141 | Species: | Danio rerio | 
        
        
        
          
            | Alignment Length: | 44 | Identity: | 10/44 - (22%) | 
          
            | Similarity: | 16/44 -  (36%) | Gaps: | 10/44 - (22%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     8 QDPLYMKEFQAIVATLTKLAKDCVM----------ILGSRQMHF 41:||.|.|..:.:.....|..:.|.:          :.||..|.|
 Zfish    98 EDPQYEKLQEDMERVRAKFRQVCSLLNVSTDFREYLSGSTSMSF 141
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
          
          
            | Gene | Sequence | Domain | Region | External ID | Identity | 
          
            | Hus1-like | NP_001262267.1 | Hus1 | 1..277 | CDD:281934 | 10/44 (23%) | 
          
            | lto1 | NP_001077021.1 | Yae1_N | 25..63 | CDD:286849 |  | 
          | Blue background indicates that the domain is not in
              the aligned region. | 
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Hieranoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | O | PTHR12900 | 
          
            | Phylome | 0 | 0.000 | Not matched by this tool. | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | SwiftOrtho | 0 | 0.000 | Not matched by this tool. | 
          
            | TreeFam | 0 | 0.000 | Not matched by this tool. | 
          
            | ZFIN | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 1 | 1.100 |  | 
        
      
           
             Return to query results.
             Submit another query.