DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hus1-like and lto1

DIOPT Version :8

Sequence 1:NP_001262267.1 Gene:Hus1-like / 40598 FlyBaseID:FBgn0026417 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001077021.1 Gene:lto1 / 563810 ZFINID:ZDB-GENE-030729-33 Length:141 Species:Danio rerio

Alignment Length:44 Identity:10/45 (22%)
Similarity:16/45 (36%) Gaps:10/45 (22%)


  Fly     8 QDPLYMKEFQAIVATLTKLAKDCVM----------ILGSRQMHF 41
            :||.|.|..:.:.....|..:.|.:          :.||..|.|
Zfish    98 EDPQYEKLQEDMERVRAKFRQVCSLLNVSTDFREYLSGSTSMSF 141

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hus1-likeNP_001262267.1 Hus1 1..277 CDD:281934 10/45 (22%)
lto1NP_001077021.1 Yae1_N 25..63 CDD:286849
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12900
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.