DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hus1-like and hus1

DIOPT Version :8

Sequence 1:NP_001262267.1 Gene:Hus1-like / 40598 FlyBaseID:FBgn0026417 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001006827.1 Gene:hus1 / 448560 XenbaseID:XB-GENE-983295 Length:282 Species:Xenopus tropicalis

Alignment Length:286 Identity:83/286 - (29%)
Similarity:148/286 - (51%) Gaps:15/286 - (5%)


  Fly     1 MKFRALMQDPLYMKEFQAIVATLTKLAKDCVMILGSRQMHFIVNEDQSSAASPLVWAGITAEEYF 65
            |:||:.:.|...:..|..::.|::||.|.|.:.|....::||:. |:.:.....:|..::...:|
 Frog     1 MRFRSKIVDVSCLNHFTRVINTISKLTKTCTLRLTVNNLYFILT-DKVANGGVSMWCELSQGNFF 64

  Fly    66 PEYRMEAAHPDQEYIVLGVSSANLGRALSVLRGGGVNSCKLKLQRIQFPCISVIASVLTSSSTEA 130
            .||:||....:|..|.|.:...||.|||...:  ...|.|:||.....||::| |..|.|.|:.:
 Frog    65 DEYQMEGVCMEQNEIFLELIPENLSRALKTAQ--NAKSVKVKLTNKHCPCLTV-ALELPSLSSSS 126

  Fly   131 REVVHDVPVTIIPGSDWSAYVVPRVPNSQLALGLPSLRLLKSLIDKLKNISPSLEFQVNVDGELN 195
            |.|.||:||::||...|:.:..|.||...:::.||:|:.:||:::::||:|..:..:.|.:||:|
 Frog   127 RIVTHDIPVSVIPRRLWNDFKEPSVPEFDVSIYLPALKTMKSVVERMKNLSNYIVIEANRNGEIN 191

  Fly   196 VIATSEMSTVTSRFQKL------LIRTVSGSQQE----ASCSVDSRKASAFFGALQLPNEELTIG 250
            :...:::.:|::.|:.|      .......|.||    |...:|.||...|....|:...:....
 Frog   192 LKIETDLVSVSTHFKDLGNPPWVSDDASQNSTQEIDNMAEARIDIRKLLQFLAGQQVNPTKAICN 256

  Fly   251 IDREHSIHLQIDVRQDVVLHSILPAV 276
            |..:..:|. |.:.:||.|...:||:
 Frog   257 IVHKRMVHF-ILLHEDVSLQYFIPAL 281

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hus1-likeNP_001262267.1 Hus1 1..277 CDD:281934 83/286 (29%)
hus1NP_001006827.1 Hus1 1..282 CDD:309219 83/286 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C226858103
eggNOG 1 0.900 E1_KOG3999
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H37932
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1053181at2759
OrthoFinder 1 1.000 FOG0002407
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.