DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hus1-like and Hus1b

DIOPT Version :8

Sequence 1:NP_001262267.1 Gene:Hus1-like / 40598 FlyBaseID:FBgn0026417 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_694712.1 Gene:Hus1b / 210554 MGIID:2671003 Length:276 Species:Mus musculus

Alignment Length:287 Identity:79/288 (27%)
Similarity:140/288 (49%) Gaps:24/288 (8%)


  Fly     1 MKFRALMQDPLYMKEFQAIVATLTKLAKDCVMILGSRQMHF----IVNEDQSSAASPLVWAGITA 61
            |:|||.:....:::.|..:.:|:.||||.||:.:...:::|    ::.|.|       :| |...
Mouse     1 MRFRARITSKRFIELFIQVSSTVAKLAKVCVLRVCPDRLYFCPMGLLGEAQ-------LW-GEMR 57

  Fly    62 EEYFPEYRMEAAHPDQEYIVLGVSSANLGRALSVLRGGGVNSCKLKLQRIQFPCISVIASVLTSS 126
            .:.|..:.||.|..:...|.|.:.|.:|.||  |...|..:|.||:|...|.||::::.. |.|.
Mouse    58 RDVFHHFCMEGASQEFNEICLELMSEHLARA--VKNAGNASSLKLQLTNKQRPCLTLVVE-LASC 119

  Fly   127 STEAREVVHDVPVTIIPGSDWSAYVVPRVPNSQLALGLPSLRLLKSLIDKLKNISPSLEFQVNVD 191
            ....|.||||:||.::|...|.....|.|..|.:::.||:|:.||::::::.|:...:..:.|::
Mouse   120 PGHTRAVVHDLPVRVLPRRRWKDCTEPHVRGSDVSVYLPALKTLKNMVERMANVGSHVLVEANLN 184

  Fly   192 GELNVIATSEMSTVTSRFQKL------LIRTVSGSQQE--ASCSVDSRKASAFFGALQLPNEELT 248
            |.:|:...::..|:.|.|:.|      ::....|...|  ....||:||....|...|:......
Mouse   185 GRMNLTVETDRVTIKSYFKNLGNPPNAVLCMSQGRDPETMVQVRVDNRKLLQCFDGHQINPTMAL 249

  Fly   249 IGIDREHSIHLQIDVRQDVVLHSILPA 275
            ..|.....:||.: |.:|:.|...:||
Mouse   250 CNILSNTLLHLVL-VHEDISLQYFIPA 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hus1-likeNP_001262267.1 Hus1 1..277 CDD:281934 79/288 (27%)
Hus1bNP_694712.1 Hus1 1..276 CDD:281934 79/288 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C226849310
eggNOG 1 0.900 E1_KOG3999
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4396
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1053181at2759
OrthoFinder 1 1.000 FOG0002407
OrthoInspector 1 1.000 T616749
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12900
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.