DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hus1-like and hus-1

DIOPT Version :8

Sequence 1:NP_001262267.1 Gene:Hus1-like / 40598 FlyBaseID:FBgn0026417 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_491203.1 Gene:hus-1 / 171939 WormBaseID:WBGene00002042 Length:277 Species:Caenorhabditis elegans

Alignment Length:288 Identity:66/289 (23%)
Similarity:124/289 (43%) Gaps:59/289 (20%)


  Fly     1 MKFRALMQDPLYMKEFQAIVATLTKLAKD-CVMILGSRQMHFIVNEDQSSAASPLVWAGIT---A 61
            |||.:|:||...:..|..|:.:::||:|. |.:.:....::||.........|   |..::   :
 Worm     1 MKFSSLLQDTAAIDVFIKILTSVSKLSKKRCCVKIEKNALNFICCSGLHDGGS---WFSLSIPYS 62

  Fly    62 EEYFPEYRMEAAHPDQE-----YIVLGVSSANLGRALSVLRGGGVNSC--KLKLQRIQ--FPCIS 117
            .:.|.::.|...:|..|     |..|.:.|     .:.||.||   .|  ||||.:.|  .|.:|
 Worm    63 SQIFRKFDMVGMNPRNEEQNLIYFELEIDS-----LVRVLPGG---HCYLKLKLSKSQKDEPMLS 119

  Fly   118 VIASVLTSSSTEAREVVHDVPVTIIPGSDWSAYVVPRVPNSQLALGLPSLRLLKSLIDKLKNISP 182
            |     ...:.||..|.|.:|:|||....|::|..|.:.:.::::.:|..:::...:...||::.
 Worm   120 V-----EVRNPEADIVSHQIPITIILSKYWNSYSRPSIGHRKMSISMPPPKMMSRFLHVFKNMNT 179

  Fly   183 S-LEFQVNVDGELNV---IATSEMSTVTSRFQ---------------KLLIRTVS-------GSQ 221
            . ::...:..|:|.:   |.|.|:....|..|               :|:||.:|       .::
 Worm   180 RVVKLTASTSGDLRISTKIETGEIDVSFSDLQTNPSETDSQEDTAKVQLMIRNISPLFQSFANTR 244

  Fly   222 QEASCSVDSRKASAFFGALQLPNEELTI 249
            ..|..::.|.:.:.|    ...||:..:
 Worm   245 TRAKMNIISNRMAEF----NFHNEDCVL 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hus1-likeNP_001262267.1 Hus1 1..277 CDD:281934 66/289 (23%)
hus-1NP_491203.1 Hus1 1..272 CDD:281934 66/289 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C225891292
eggNOG 1 0.900 E1_KOG3999
Hieranoid 1 1.000
Homologene 1 1.000 H37932
Inparanoid 1 1.050 61 1.000 Inparanoid score I3965
Isobase 1 0.950 0 Normalized mean entropy S5411
OMA 1 1.010
OrthoDB 1 1.010 D1053181at2759
OrthoFinder 1 1.000 FOG0002407
OrthoInspector 1 1.000 T475217
orthoMCL 1 0.900 OOG5_130761
Panther 1 1.100 LDO PTHR12900
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R579
TreeFam 1 0.960
1413.840

Return to query results.
Submit another query.